Human IL21

Goat

Human (tested or 100% immunogen sequence identity)

IgG Polyclonal

Unconjugated

Affinity purified

Unmodified

Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-Terminus of human IL-21. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%); Gibbon, Monkey, Marmoset (97%); Sheep, Bovine, Horse (93%); Elephant, Dog (90%); Panda, Cat, Pig (83%).

aa40-68

Recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a, a 155 amino acid pro-cytokine, reduced to 133 amino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence at the C-terminus. Recognizes an epitope within the N-terminal (NT) region of human interleukin-21 (IL-21) and is expected to bind both isoforms. IL-21 enhances the proliferation/differentiation of stimulated B-cells, the proliferation of bone marrow progenitor cells, and increases the activity of NK cells and disease-specific CD8+ T-cells. IL-21 signals through binding to the specific type I cytokine receptor IL-21R, coupled with the common cytokine receptor g chain (gc), initiating the activation of the JAK/STAT signalling pathway. Is suitable for use in immunocytochemistry on human spleen or tonsil cells.

• IHC
• IHC - Paraffin
• ELISA (1:50000)

PBS, 0.1% Sodium Azide, 0.1% BSA

Store at -20°C. Do not use frost-free freezers. Store undiluted. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: Q9HBE4 NCBI: NM_021803 NP_068575.1