Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407813-100 100 µg $470 
IDH1 / IDH Antibody - IHC analysis of IDH1 using anti-IDH1 antibody. IDH1 was detected in immunocytochemical section of A549 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDH1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
IDH1 / IDH Antibody - IHC analysis of IDH1 using anti-IDH1 antibody. IDH1 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDH1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
IDH1 / IDH Antibody - IDH1 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
IDH1 / IDH Antibody - IDH1 antibody IHC-paraffin. IHC(P): Mouse Testis Tissue.
IDH1 / IDH Antibody - IDH1 antibody IHC-paraffin. IHC(P): Rat Testis Tissue.
IDH1 / IDH Antibody - IDH1 antibody Western blot. All lanes: Anti IDH1 at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: Rat Kidney Tissue Lysate at 50 ug. Lane 3: Rat Brain Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: SMMC Whole Cell Lysate at 40 ug. Lane 6: A549 Whole Cell Lysate at 40 ug. Lane 7: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 47 kD. Observed band size: 47 kD.
IDH1 / IDH Antibody - Flow Cytometry analysis of HepG2 cells using anti-IDH1 antibody. Overlay histogram showing HepG2 cells stained with anti-IDH1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IDH1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
IDH1 / IDH Antibody - IHC analysis of IDH1 using anti-IDH1 antibody. IDH1 was detected in immunocytochemical section of A549 cell. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDH1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
IDH1 / IDH Antibody - IHC analysis of IDH1 using anti-IDH1 antibody. IDH1 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-IDH1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
IDH1 / IDH Antibody - IDH1 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
IDH1 / IDH Antibody - IDH1 antibody IHC-paraffin. IHC(P): Mouse Testis Tissue.
IDH1 / IDH Antibody - IDH1 antibody IHC-paraffin. IHC(P): Rat Testis Tissue.
IDH1 / IDH Antibody - IDH1 antibody Western blot. All lanes: Anti IDH1 at 0.5 ug/ml. Lane 1: Rat Lung Tissue Lysate at 50 ug. Lane 2: Rat Kidney Tissue Lysate at 50 ug. Lane 3: Rat Brain Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: SMMC Whole Cell Lysate at 40 ug. Lane 6: A549 Whole Cell Lysate at 40 ug. Lane 7: NIH3T3 Whole Cell Lysate at 40 ug. Predicted band size: 47 kD. Observed band size: 47 kD.
IDH1 / IDH Antibody - Flow Cytometry analysis of HepG2 cells using anti-IDH1 antibody. Overlay histogram showing HepG2 cells stained with anti-IDH1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-IDH1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human IDH1 / IDH Antibody (aa381‑413, IHC, WB) LS‑C407813

Polyclonal Rabbit anti‑Human IDH1 / IDH Antibody (aa381‑413, IHC, WB) LS‑C407813

Antibody:
IDH1 / IDH Rabbit anti-Human Polyclonal (aa381-413) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bat, Pig
Format:
Unconjugated, Unmodified
Price
Catalog Number
$470
LS-C407813-100
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
IDH1 / IDH Rabbit anti-Human Polyclonal (aa381-413) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bat, Pig
Format:
Unconjugated, Unmodified

Specifications

Description
IDH antibody LS-C407813 is an unconjugated rabbit polyclonal antibody to IDH (IDH1) (aa381-413) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human IDH1 / IDH
Synonyms
IDH1 | IDCD | IDP | IDPC | PICD | NADP(+)-specific ICDH | IDH | Oxalosuccinate decarboxylase
Host
Rabbit
Reactivity
Human, Mouse, Rat, Bat, Pig (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human IDH1 (381-413 aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK), different from the related mouse and rat sequences by one amino acid.
Epitope
aa381-413
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About IDH1 / IDH
O75874 NM_005896 NP_005887.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/11/2025