Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C756640-10 10 µg $318 
LS-C756640-100 100 µg $470 
HSPA1A Antibody - IHC analysis of Hsp70 using anti-Hsp70 antibody. Hsp70 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-Hsp70 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
HSPA1A Antibody - Western blot analysis of Hsp70 using anti-Hsp70 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysate,Lane 2: human COLO-320 whole cell lysate,Lane 3: human SW620 whole cell lysate,Lane 4: human A431 whole cell lysate,Lane 5: human A549 whole cell lysate,Lane 6: human HepG2 whole cell lysate,Lane 7: human PANC-1 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Hsp70 antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
HSPA1A Antibody - Flow Cytometry analysis of U20S cells using anti-Hsp70 antibody. Overlay histogram showing U20S cells stained with anti-Hsp70 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Hsp70 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
HSPA1A Antibody - IHC analysis of Hsp70 using anti-Hsp70 antibody. Hsp70 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/ml mouse anti-Hsp70 antibody overnight at 4°C. Biotinylated goat anti-mouse IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
HSPA1A Antibody - Western blot analysis of Hsp70 using anti-Hsp70 antibody. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human Hela whole cell lysate,Lane 2: human COLO-320 whole cell lysate,Lane 3: human SW620 whole cell lysate,Lane 4: human A431 whole cell lysate,Lane 5: human A549 whole cell lysate,Lane 6: human HepG2 whole cell lysate,Lane 7: human PANC-1 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with mouse anti-Hsp70 antigen affinity purified monoclonal antibody at 0.5 µg/mL overnight at 4°C, then washed with TBS-0.1% Tween 3 times with 5 minutes each and probed with a goat anti-mouse IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system.
HSPA1A Antibody - Flow Cytometry analysis of U20S cells using anti-Hsp70 antibody. Overlay histogram showing U20S cells stained with anti-Hsp70 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with mouse anti-Hsp70 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-mouse IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was mouse IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 3
2 of 3
3 of 3

Monoclonal Mouse anti‑Human HSPA1A Antibody (IHC, WB) LS‑C756640

Monoclonal Mouse anti‑Human HSPA1A Antibody (IHC, WB) LS‑C756640

Antibody:
HSPA1A Mouse anti-Human Monoclonal Antibody
Application:
IHC-P, IHC-Fr, ICC, WB, Flo
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C756640-10
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
HSPA1A Mouse anti-Human Monoclonal Antibody
Application:
IHC-P, IHC-Fr, ICC, WB, Flo
Reactivity:
Human, Mouse, Rat
Format:
Unconjugated, Unmodified

Specifications

Description
HSPA1A antibody LS-C756640 is an unconjugated mouse monoclonal antibody to HSPA1A from human. It is reactive with human, mouse and rat. Validated for Flow, ICC, IHC and WB.
Target
Human HSPA1A
Synonyms
HSPA1A | Heat shock 70kDa protein 1A | Heat shock 70 kDa protein 1/2 | Heat shock 70kD protein 1A | HSP70-1/HSP70-2 | HSPA1 | HSP70-1A | Heat shock 70 kd protein 1 | Heat shock-induced protein | Iroquois homeobox protein 4 | HSP70-1 | Hsp70.1 | HSP70.1/HSP70.2 | HSP70I | HSP72
Host
Mouse
Reactivity
Human, Mouse, Rat (tested or 100% immunogen sequence identity)
Clonality
IgG1 Monoclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human Hsp70 (559-596 aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.
Specificity
No cross reactivity with other proteins.
Applications
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • IHC - Frozen (0.5 - 1 µg/ml)
  • ICC (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
  • Flow Cytometry (1 - 3 µg/10E6 cells)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
Applications should be user optimized.
Presentation
Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
After reconstitution, may be stored at 4°C for 1 month. For long-term storage and to avoid freeze-thaw cycles, aliquot and store at -20°C.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HSPA1A

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 1/11/2025