Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407848-100 100 µg $470 
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Human Placenta Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Mouse Testis Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody Western blot. All lanes: Anti Hsp90 beta at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 90 kD. Observed band size: 90 kD.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Human Placenta Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody IHC-paraffin. IHC(P): Mouse Testis Tissue.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of mouse brain tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - IF analysis of HSP90AB1 using anti-HSP90AB1 antibody HSP90AB1 was detected in paraffin-embedded section of human lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution ) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-HSP90AB1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
HSP90AB1 / HSP90 Alpha B1 Antibody - Hsp90 beta antibody Western blot. All lanes: Anti Hsp90 beta at 0.5 ug/ml. Lane 1: Rat Testis Tissue Lysate at 50 ug. Lane 2: Rat Thymus Tissue Lysate at 50 ug. Lane 3: Human Placenta Tissue Lysate at 50 ug. Lane 4: SW620 Whole Cell Lysate at 40 ug. Lane 5: HELA Whole Cell Lysate at 40 ug. Predicted band size: 90 kD. Observed band size: 90 kD.
1 of 9
2 of 9
3 of 9
4 of 9
5 of 9
6 of 9
7 of 9
8 of 9
9 of 9

Polyclonal Rabbit anti‑Human HSP90AB1 / HSP90 Alpha B1 Antibody (aa449‑481, IHC, WB) LS‑C407848

Polyclonal Rabbit anti‑Human HSP90AB1 / HSP90 Alpha B1 Antibody (aa449‑481, IHC, WB) LS‑C407848

Antibody:
HSP90AB1 / HSP90 Alpha B1 Rabbit anti-Human Polyclonal (aa449-481) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep
Format:
Unconjugated, Unmodified
Price
Catalog Number
$470
LS-C407848-100
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
HSP90AB1 / HSP90 Alpha B1 Rabbit anti-Human Polyclonal (aa449-481) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep
Format:
Unconjugated, Unmodified

Specifications

Description
HSP90 Alpha B1 antibody LS-C407848 is an unconjugated rabbit polyclonal antibody to HSP90 Alpha B1 (HSP90AB1) (aa449-481) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human HSP90AB1 / HSP90 Alpha B1
Synonyms
HSP90AB1 | D6S182 | Heat shock 84 kDa | Heat shock protein beta | Heat shock protein HSP 90-beta | HSP 84 | HSP84 | HSP 90 | HSP90-BETA | HSP90B | HSPC2 | HSPCB
Host
Rabbit
Reactivity
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Hamster, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human Hsp90 beta (449-481 aa RRLSELLRYHTSQSGDEMTSLSEYVSRMKETQK), identical to the related mouse and rat sequences.
Epitope
aa449-481
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Usage
IHC: Antigen retrieval by boiling the paraffin sections in 10 mM citrate buffer, pH6.0, for 20 minutes is required for the staining of formalin/paraffin sections.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About HSP90AB1 / HSP90 Alpha B1
P08238 NM_007355 NP_031381.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/15/2025