Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C407753-100 100 µg $470 
CRY1 Antibody - IHC analysis of CRY1 using anti-CRY1 antibody. CRY1 was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CRY1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CRY1 Antibody - IHC analysis of CRY1 using anti-CRY1 antibody. CRY1 was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CRY1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CRY1 Antibody - IHC analysis of CRY1 using anti-CRY1 antibody. CRY1 was detected in paraffin-embedded section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CRY1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CRY1 Antibody - Cryptochrome I antibody Western blot. All lanes: Anti Cryptochrome I at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Testis Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 66 kD. Observed band size: 66 kD.
CRY1 Antibody - IHC analysis of CRY1 using anti-CRY1 antibody. CRY1 was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CRY1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CRY1 Antibody - IHC analysis of CRY1 using anti-CRY1 antibody. CRY1 was detected in paraffin-embedded section of rat intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CRY1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CRY1 Antibody - IHC analysis of CRY1 using anti-CRY1 antibody. CRY1 was detected in paraffin-embedded section of mouse intestine tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-CRY1 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
CRY1 Antibody - Cryptochrome I antibody Western blot. All lanes: Anti Cryptochrome I at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Rat Testis Tissue Lysate at 50 ug. Lane 3: HELA Whole Cell Lysate at 40 ug. Predicted band size: 66 kD. Observed band size: 66 kD.
1 of 4
2 of 4
3 of 4
4 of 4

Polyclonal Rabbit anti‑Human CRY1 Antibody (aa153‑189, WB) LS‑C407753

Polyclonal Rabbit anti‑Human CRY1 Antibody (aa153‑189, WB) LS‑C407753

Antibody:
CRY1 Rabbit anti-Human Polyclonal (aa153-189) Antibody
Application:
WB
Reactivity:
Human, Rat, Bovine, Horse, Pig, Sheep
Format:
Unconjugated, Unmodified
Price
Catalog Number
$470
LS-C407753-100
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
CRY1 Rabbit anti-Human Polyclonal (aa153-189) Antibody
Application:
WB
Reactivity:
Human, Rat, Bovine, Horse, Pig, Sheep
Format:
Unconjugated, Unmodified

Specifications

Description
CRY1 antibody LS-C407753 is an unconjugated rabbit polyclonal antibody to CRY1 (aa153-189) from human. It is reactive with human, rat, bovine and other species. Validated for WB.
Target
Human CRY1
Synonyms
CRY1 | Chryptochrome 1 | Cryptochrome-1 | Photolyase homolog 1 | PHLL1
Host
Rabbit
Reactivity
Human, Rat, Bovine, Horse, Pig, Sheep (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the N-Terminus of human Cryptochrome I (153-189 aa FQTLISKMEPLEIPVETITSEVIEKCTTPLSDDHDEK), different from the related mouse sequence by seven amino acids, and from the related rat sequence by six amino aci
Epitope
aa153-189
Applications
  • Western blot (0.1 - 0.5 µg/ml)
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CRY1
Q16526 NM_004075 NP_004066.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/3/2025