Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Location


Corporate Headquarters

Vector Laboratories, Inc.
6737 Mowry Ave
Newark, CA 94560
United States

Telephone Numbers



Customer Service: (800) 227-6666 / (650) 697-3600


Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C662462-100 100 µg $470 
CCNT1 / Cyclin T1 Antibody - Cyclin T1 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody
CCNT1 / Cyclin T1 Antibody - Cyclin T1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody
CCNT1 / Cyclin T1 Antibody - Cyclin T1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody
CCNT1 / Cyclin T1 Antibody - IF analysis of Cyclin T1 using anti-Cyclin T1 antibody Cyclin T1 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-Cyclin T1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
CCNT1 / Cyclin T1 Antibody - Western blot - Anti-Cyclin T1 Picoband Antibody
CCNT1 / Cyclin T1 Antibody - Flow Cytometry analysis of U937 cells using anti-Cyclin T1 antibody. Overlay histogram showing U937 cells stained with anti-Cyclin T1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Cyclin T1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CCNT1 / Cyclin T1 Antibody - Flow Cytometry analysis of U20S cells using anti-Cyclin T1 antibody. Overlay histogram showing U20S cells stained with anti-Cyclin T1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Cyclin T1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CCNT1 / Cyclin T1 Antibody - Cyclin T1 was detected in paraffin-embedded sections of human intestinal cancer tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody
CCNT1 / Cyclin T1 Antibody - Cyclin T1 was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody
CCNT1 / Cyclin T1 Antibody - Cyclin T1 was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- Cyclin T1 Antigen Affinity purified polyclonal antibody
CCNT1 / Cyclin T1 Antibody - IF analysis of Cyclin T1 using anti-Cyclin T1 antibody Cyclin T1 was detected in immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2µg/mL rabbit anti-Cyclin T1 Antibody overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
CCNT1 / Cyclin T1 Antibody - Western blot - Anti-Cyclin T1 Picoband Antibody
CCNT1 / Cyclin T1 Antibody - Flow Cytometry analysis of U937 cells using anti-Cyclin T1 antibody. Overlay histogram showing U937 cells stained with anti-Cyclin T1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Cyclin T1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
CCNT1 / Cyclin T1 Antibody - Flow Cytometry analysis of U20S cells using anti-Cyclin T1 antibody. Overlay histogram showing U20S cells stained with anti-Cyclin T1 antibody (Blue line). The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Cyclin T1 Antibody (1µg/10E6 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (5-10µg/10E6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1µg/10E6 cells) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
1 of 7
2 of 7
3 of 7
4 of 7
5 of 7
6 of 7
7 of 7

Polyclonal Rabbit anti‑Human CCNT1 / Cyclin T1 Antibody (IHC, WB) LS‑C662462

Polyclonal Rabbit anti‑Human CCNT1 / Cyclin T1 Antibody (IHC, WB) LS‑C662462

Antibody:
CCNT1 / Cyclin T1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified
Price
Catalog Number
$470
LS-C662462-100
Toll Free North America
(800) 227-6666
For Research Use Only

Overview

Antibody:
CCNT1 / Cyclin T1 Rabbit anti-Human Polyclonal Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human
Format:
Unconjugated, Unmodified

Specifications

Description
Cyclin T1 antibody LS-C662462 is an unconjugated rabbit polyclonal antibody to human Cyclin T1 (CCNT1). Validated for IHC and WB.
Target
Human CCNT1 / Cyclin T1
Synonyms
CCNT1 | CCNT | CDK9-associated C-type protein | Cyclin T1b | CYCT1 | Cyclin T1 | HIVE1 | Cyclin C-related protein | Cyclin-T | Cyclin-T1
Host
Rabbit
Reactivity
Human (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410 aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM), different from the related mouse sequence by one amino acid.
Specificity
Ubiquitously expressed.
Applications
  • IHC
  • IHC - Paraffin
  • Western blot
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About CCNT1 / Cyclin T1
O60563 NM_001240 NP_001231.2

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 4/17/2025