Human ATP2A2 / SERCA2

Rabbit

Human, Chimpanzee, Gibbon, Monkey, Mouse, Rat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep (tested or 100% immunogen sequence identity)

Polyclonal

Unconjugated

Immunogen affinity purified

Unmodified

A synthetic peptide corresponding to a sequence at the N-Terminus of human SERCA2 ATPase (1-32 aa MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL), identical to the related mouse and rat sequences.

aa1-32

Isoform 1 is widely expressed in smooth muscle and nonmuscle tissues such as in adult skin epidermis, with highest expression in liver, pancreas and lung, and intermediate expression in brain, kidney and placenta. Also expressed at lower levels in heart and skeletal muscle. Isoforms 2 and 3 are highly expressed in the heart and slow twitch skeletal muscle. Expression of isoform 3 is predominantly restricted to cardiomyocytes and in close proximity to the sarcolemma. Both isoforms are mildly expressed in lung, kidney, liver, pancreas and placenta. Expression of isoform 3 is amplified during monocytic differentiation and also observed in the fetal heart. .

• IHC
• IHC - Paraffin
• Western blot

Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose

Add 0.2ml of distilled water will yield a concentration of 500µg/ml.

At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.

For research use only. Intended for use by laboratory professionals.

This antibody carries the LSBio 100% Guarantee.

Uniprot: P16615 NCBI: NM_001681 NP_001672.1