Target
Human ADRA1A
Synonyms
ADRA1A | ADRA1L1 | Adrenergic alpha 1c receptor | Alpha 1c adrenoceptor | Alpha-adrenergic receptor 1c | ADRA1C | Adrenoceptor alpha 1A | Alpha-1A adrenoceptor | Alpha-1A adrenoreceptor | Alpha-1A adrenergic receptor | Alpha-1C adrenergic receptor | ALPHA1AAR | Alpha1C-AR
Reactivity
Human, Mouse
(tested or 100% immunogen sequence identity)
Purification
Immunogen affinity purified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human ADRA1A (335-373 aa KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD), different from the related mouse and rat sequences by four amino acids.
Specificity
Expressed in heart, brain, liver and prostate, but not in kidney, lung, adrenal, aorta and pituitary. Within the prostate, expressed in the apex, base, periurethral and lateral lobe. Isoform 4 is the most abundant isoform expressed in the prostate with high levels also detected in liver and heart. .