Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-G136407-20 20 µg $405 
LS-G136407-100 100 µg $598 
LS-G136407-1 1 mg $1,679 
PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
PHB / Prohibitin Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
PHB / Prohibitin Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
1 of 3
2 of 3
3 of 3

Mouse PHB / Prohibitin Protein (Recombinant 10His, N-terminus) - LS-G136407

Mouse PHB / Prohibitin Protein (Recombinant 10His, N-terminus) - LS-G136407

Description:
PHB / Prohibitin Protein LS-G136407 is a Recombinant Mouse PHB / Prohibitin produced in E. coli 41-173aa with 10His, N-terminus tag(s). For Research Use Only
Price
Catalog Number
$405
LS-G136407-20
Toll Free North America
206-374-1102
For Research Use Only

Overview

Description:
PHB / Prohibitin Protein LS-G136407 is a Recombinant Mouse PHB / Prohibitin produced in E. coli 41-173aa with 10His, N-terminus tag(s). For Research Use Only

Specifications

Type
Recombinant Protein
Target
PHB / Prohibitin
Synonyms
PHB | PHB1 | Prohibitin
Species
Mouse
Modifications
Unmodified
Conjugations
Unconjugated
Tag
10His, N-terminus
Region
41-173aa
Predicted Molecular Weight
20.5 kDa
AA Sequence
RFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHL
Expression System
E. coli
Source Species
E. coli
Purification
Greater than 85% by SDS-PAGE
Usage Summary
Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging (By similarity).
Bio-Activity
Not Tested
Endotoxin
Not Tested
Presentation
Lyophilized from Tris, 50% Glycerol
Storage
Store at -80°C for up to 1 year. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This protein carries the LSBio 100% Guarantee.
LSBio Guarantee
About PHB / Prohibitin
P35232 NM_002634 NP_002625.1

Publications (0)

Customer Reviews (0)

Images

Mass Cytometry

PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.

Mass Cytometry

PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PHB / Prohibitin Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.

Mass Cytometry

PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PHB / Prohibitin Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.

Mass Cytometry

PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PHB / Prohibitin Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Mass Cytometry

PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.

Mass Cytometry

PHB / Prohibitin Protein - Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of Recombinant Mouse Prohibitin(Phb),partial could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Phb.

Sodium Dodecyl Sulfate - Polyacrylamide Gel Electrophoresis

PHB / Prohibitin Protein - (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 9/26/2024