Products
Research Areas
COVID-19
Resources
Login
Quick Order
Cart Cart lightblue
Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Contact Us

Locations


Orders Processing,
Shipping & Receiving,
Warehouse

2 Shaker Rd Suites
B001/B101
Shirley, MA 01464


Production Lab

Floor 6, Suite 620
20700 44th Avenue W
Lynnwood, WA 98036

Telephone Numbers



Tel: +1 (206) 374-1102
Fax: +1 (206) 577-4565

Contact Us



Additional Contact Details

Login
Registration enables users to use special features of this website, such as past
order histories, retained contact details for faster checkout, review submissions, and special promotions.


Fields marked with a * are required.

Login
Quick Order
Catalog Number Size Price
LS-C408009-10 10 µg $318 
LS-C408009-100 100 µg $470 
RBBP4 / RBAP48 Antibody - IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in frozen section of mouse liver tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-RbAp48 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
RBBP4 / RBAP48 Antibody - IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in frozen section of mouse small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-RbAp48 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
RBBP4 / RBAP48 Antibody - IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-RbAp48 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
RBBP4 / RBAP48 Antibody - IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in frozen section of human placenta tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-RbAp48 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
RBBP4 / RBAP48 Antibody - RbAp48 antibody IHC-paraffin. IHC(P): Mouse Liver Tissue.
RBBP4 / RBAP48 Antibody - RbAp48 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
RBBP4 / RBAP48 Antibody - RbAp48 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
RBBP4 / RBAP48 Antibody - RbAp48 antibody Western blot. All lanes: Anti RbAp48 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: Mouse Lung Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: JURKAT Whole Cell Lysate at 40 ug. Predicted band size: 54 kD. Observed band size: 54 kD.
RBBP4 / RBAP48 Antibody - IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in frozen section of mouse liver tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-RbAp48 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
RBBP4 / RBAP48 Antibody - IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in frozen section of mouse small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-RbAp48 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
RBBP4 / RBAP48 Antibody - IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in frozen section of rat small intestine tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-RbAp48 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
RBBP4 / RBAP48 Antibody - IHC analysis of RbAp48 using anti-RbAp48 antibody. RbAp48 was detected in frozen section of human placenta tissue . Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1µg/ml rabbit anti-RbAp48 Antibody overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC) with DAB as the chromogen.
RBBP4 / RBAP48 Antibody - RbAp48 antibody IHC-paraffin. IHC(P): Mouse Liver Tissue.
RBBP4 / RBAP48 Antibody - RbAp48 antibody IHC-paraffin. IHC(P): Rat Intestine Tissue.
RBBP4 / RBAP48 Antibody - RbAp48 antibody IHC-paraffin. IHC(P): Human Intestinal Cancer Tissue.
RBBP4 / RBAP48 Antibody - RbAp48 antibody Western blot. All lanes: Anti RbAp48 at 0.5 ug/ml. Lane 1: Rat Brain Tissue Lysate at 50 ug. Lane 2: Mouse Liver Tissue Lysate at 50 ug. Lane 3: Mouse Lung Tissue Lysate at 50 ug. Lane 4: HELA Whole Cell Lysate at 40 ug. Lane 5: JURKAT Whole Cell Lysate at 40 ug. Predicted band size: 54 kD. Observed band size: 54 kD.
1 of 8
2 of 8
3 of 8
4 of 8
5 of 8
6 of 8
7 of 8
8 of 8

Polyclonal Rabbit anti‑Human RBBP4 / RBAP48 Antibody (aa395‑425, IHC, WB) LS‑C408009

Polyclonal Rabbit anti‑Human RBBP4 / RBAP48 Antibody (aa395‑425, IHC, WB) LS‑C408009

Antibody:
RBBP4 / RBAP48 Rabbit anti-Human Polyclonal (aa395-425) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken
Format:
Unconjugated, Unmodified
Price
Catalog Number
$318
LS-C408009-10
Toll Free North America
206-374-1102
For Research Use Only

Overview

Antibody:
RBBP4 / RBAP48 Rabbit anti-Human Polyclonal (aa395-425) Antibody
Application:
IHC, IHC-P, WB
Reactivity:
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken
Format:
Unconjugated, Unmodified

Specifications

Description
RBAP48 antibody LS-C408009 is an unconjugated rabbit polyclonal antibody to RBAP48 (RBBP4) (aa395-425) from human. It is reactive with human, mouse, rat and other species. Validated for IHC and WB.
Target
Human RBBP4 / RBAP48
Synonyms
RBBP4 | CAF-I p48 | CAF-1 subunit C | CAF-I 48 kDa subunit | MSI1 protein homolog | Histone-binding protein RBBP4 | NURF55 | RBBP-4 | RBAP48
Host
Rabbit
Reactivity
Human, Mouse, Rat, Bat, Bovine, Dog, Guinea pig, Horse, Pig, Rabbit, Sheep, Chicken (tested or 100% immunogen sequence identity)
Clonality
Polyclonal
Conjugations
Unconjugated
Purification
Immunogen affinity purified
Modifications
Unmodified
Immunogen
A synthetic peptide corresponding to a sequence at the C-Terminus of human RbAp48 (395-425 aa EDNIMQVWQMAENIYNDEDPEGSVDPEGQGS), identical to the related mouse sequence.
Epitope
aa395-425
Applications
  • IHC
  • IHC - Paraffin (0.5 - 1 µg/ml)
  • Western blot (0.1 - 0.5 µg/ml)
Performing IHC? See our complete line of Immunohistochemistry Reagents including antigen retrieval solutions, blocking agents ABC Detection Kits and polymers, biotinylated secondary antibodies, substrates and more.
Presentation
Lyophilized from 0.2mg Na2HPO4, 5mg BSA, 0.9mg NaCl, 0.05mg sodium azide.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500µg/ml.
Storage
At -20°C for 1 year. After reconstitution, at 4°C for 1 month. It can also be aliquotted and stored frozen at -20°C for a longer time. Avoid freeze-thaw cycles.
Restrictions
For research use only. Intended for use by laboratory professionals.
Guarantee
This antibody carries the LSBio 100% Guarantee.
LSBio Guarantee
About RBBP4 / RBAP48
Q09028 NM_005610 NP_005601.1

Publications (0)

Customer Reviews (0)


Request SDS/MSDS

To request an SDS/MSDS form for this product, please contact our Technical Support department at:

Technical.Support@LSBio.com

Requested From: United States
Date Requested: 9/26/2024